PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G1009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 509aa    MW: 56444.6 Da    PI: 8.902
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G1009genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46e-1759105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
      Gh_D13G1009  59 KGGWTPEEDETLRNAVAAFKGKSWKKIAEFFP-DRSEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding57.62.9e-18111157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ed++++++v ++G+  W+ Ia+ ++ gR +kqc++rw+++l
      Gh_D13G1009 111 KGPWTQKEDDKIIELVSKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 157
                      79******************************.*************97 PP

3Myb_DNA-binding47.83.3e-15163206146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l + ++ +G++ W+ Ia+ ++ gRt++ +k++w++
      Gh_D13G1009 163 KDAWTMEEELALMNTHRTYGNK-WAEIAKVLP-GRTDNAIKNHWNS 206
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.81954105IPR017930Myb domain
SMARTSM007171.2E-1458107IPR001005SANT/Myb domain
PfamPF002491.4E-1559105IPR001005SANT/Myb domain
SuperFamilySSF466892.44E-1560115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-2261117IPR009057Homeodomain-like
CDDcd001671.06E-1262105No hitNo description
PROSITE profilePS5129431.635106161IPR017930Myb domain
SuperFamilySSF466892.73E-31108204IPR009057Homeodomain-like
SMARTSM007172.4E-17110159IPR001005SANT/Myb domain
PfamPF002498.6E-18111157IPR001005SANT/Myb domain
CDDcd001675.42E-15113157No hitNo description
Gene3DG3DSA:1.10.10.605.2E-27118164IPR009057Homeodomain-like
PROSITE profilePS5129420.954162212IPR017930Myb domain
SMARTSM007172.6E-13162210IPR001005SANT/Myb domain
PfamPF002499.1E-14163206IPR001005SANT/Myb domain
CDDcd001675.45E-10165208No hitNo description
Gene3DG3DSA:1.10.10.606.7E-23165212IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MAELRLEERC LYKKQLTTAS SSSVSEGGGN AVVKSPGVSS PAPTSPNHRR TTGPIRRAKG  60
GWTPEEDETL RNAVAAFKGK SWKKIAEFFP DRSEVQCLHR WQKVLNPDLV KGPWTQKEDD  120
KIIELVSKYG PTKWSVIAKS LPGRIGKQCR ERWHNHLNPD IKKDAWTMEE ELALMNTHRT  180
YGNKWAEIAK VLPGRTDNAI KNHWNSSLKK KLDFYLATGK LPPVSKNGLQ NGTKDIRTPT  240
TQNFPVFLKK ESGSTAQTSS GTTDTCKLEE DGKDQLESSA PVQDMTASTN VIPEEPTDTE  300
STECKLQSVD INPCYCTSES GGKFGSHRIS SQVVEILKEQ VGLDTPTYCS LCCDESPRSQ  360
HEWTSTPITS PISFFTPPRV KGSGLSTHSP EYILRVAAKS FLNTPSIFRK RKMGAQVLTL  420
PNKKGKLNEE IGKDGIQLSG EQQRTENSSE QAQFCDGDPC ESPACQGNSP TLPNSTVFNA  480
SPPYRLRSKR TAVLKSVERK LELTFDKEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C7e-70582125159MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-70582125159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012442451.10.0PREDICTED: myb-related protein A-like
RefseqXP_012442444.10.0PREDICTED: myb-related protein A-like
TrEMBLA0A0D2Q4450.0A0A0D2Q445_G
STRINGPOPTR_0006s08570.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.21e-150myb domain protein 3r-3